
Yeast-Derived TMPRSS2 Recombinant HIS Tagged Lyophilized
IYSTTMPRSS2HIS10UGYeast-Derived TMPRSS2 Recombinant HIS Tagged Lyophilized from Innovative Research is a recombinant protein provided as a Liquid in 20 mM Tris-HCl based buffer, pH 8.0 powder. This preparation is buffered in 20 mM Tris-HCl based buffer, pH 8.0 and has purity of greater than 90%. This protein has been recombinantly produced in mammalian cells and is HIS tagged.
More Details:
- Host:Human
- Species: Yeast-Derived
- Target: Transmembrane Protease Serine 2 (TMPRSS2)
- Residues:
- Gene ID: 7113
- Gene Alias: PP9284, PRSS10
- Swissprot ID: O15393
- Tag: HIS Tagged
- Storage Conditions:-20C
Aliquot in working volumes to avoid multiple freeze/thaw cycles and store at -80C.
Protein Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
. At Innovative Research, we provide reliable, consistent products that deliver reliable, consistent results.
These products are supplied for manufacturing, research and laboratory use only. Researchers and laboratory personnel intending to use any of these products for medical investigation on humans are solely responsible for such use and for compliance with the pertinent regulations of the United States Food and Drug Administration (US-FDA) and other regulations. We do not assume liability for damages resulting from the handling, use and/or disposal of these products, from their use in violation of patent or other rights or reliance upon this information.
Please be aware the image pictured is for illustrative purposes only, and your product packaging and appearance may vary.
Get in touch with our team! Please include any relevant information (product name, etc)