
Yeast-Derived TMPRSS2 Recombinant HIS Tagged Lyophilized
IYSTTMPRSS2HIS10UGYeast-Derived TMPRSS2 Recombinant HIS Tagged Lyophilized from Innovative Research is a recombinant protein provided as a Liquid in 20 mM Tris-HCl based buffer, pH 8.0 powder. This preparation is buffered in 20 mM Tris-HCl based buffer, pH 8.0 and has purity of greater than 90%. This protein has been recombinantly produced in mammalian cells and is HIS tagged.
More Details:
- Host:Human
- Species: Yeast-Derived
- Target: Transmembrane Protease Serine 2 (TMPRSS2)
- Residues:
- Gene ID: 7113
- Gene Alias: PP9284, PRSS10
- Swissprot ID: O15393
- Tag: HIS Tagged
- Storage Conditions:-20C
Aliquot in working volumes to avoid multiple freeze/thaw cycles and store at -80C.
Protein Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
. At Innovative Research, we provide reliable, consistent products that deliver reliable, consistent results.
This material is sold for in-vitro use only for manufacturing and research. This material is not suitable for human or animal use. While we make every effort to ensure the safety of our products, we recommend handling any biological materials with standard precautions as if capable of spreading infectious disease. The statements herin are offered for informational purposes only to be used solely for your consideration, investigation, and verification.
Please be aware the image pictured is for illustrative purposes only, and your product packaging and appearance may vary.
Get in touch with our team! Please include any relevant information (product name, etc)