
Rabbit Anti Multi-Species Furin (PACE) N-Terminal Polyclonal Affinity Purified FITC Labeled
IRBAMLFURNTAPFITC100ULRabbit Anti Multi-Species Furin (PACE) N-Terminal Polyclonal Affinity Purified FITC Labeled from Innovative Research is a polyclonal antibody provided as a Liquid buffered in 1x PBS. This antibody was produced against a synthetic peptide directed toward the N-terminal region of human Furin located within the following region: RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI.
More Details:
- Host:Rabbit
- Species: Multi-Species
- Cross-Reactivity: Canine: 100%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Bovine: 93%, Sheep: 93%, Zebrafish: 86%
- Target: Furin (PACE)
- Gene ID: 5045
- Gene Alias: FUR, PACE, PCSK3, SPC1
- Swissprot ID: P09958
- Molecular Weight: 74kDa
- Purification: Affinity Purified
- Clonality: Polyclonal
- Storage Conditions:4C
Conjugated antibody is stable for 12 months at 4C. For longer term storage, dilute with up to 50% glycerol and store in working aliquots at -20 to -80C. Store in light-protected vials. Avoid repeated freeze/thaw cycles, as this can comprimise both enzyme activity and antibody binding. This product can be used for a wide range of research applications, including WB, and more. At Innovative Research, we provide reliable, consistent products that deliver reliable, consistent results.
This material is sold for in-vitro use only for manufacturing and research. This material is not suitable for human or animal use. While we make every effort to ensure the safety of our products, we recommend handling any biological materials with standard precautions as if capable of spreading infectious disease. The statements herin are offered for informational purposes only to be used solely for your consideration, investigation, and verification.
Please be aware the image pictured is for illustrative purposes only, and your product packaging and appearance may vary.
Get in touch with our team! Please include any relevant information (product name, etc)