
Rabbit Anti Multi-Species Furin (PACE) N-Terminal Polyclonal Affinity Purified
IRBAMLFURNTAP100ULRabbit Anti Multi-Species Furin (PACE) N-Terminal Polyclonal Affinity Purified from Innovative Research is a polyclonal antibody provided as a Liquid buffered in 1x PBS, 0.09% (w/v) sodium azide, 2% sucrose. This antibody was produced against a synthetic peptide directed toward the N-terminal region of human Furin located within the following region: RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI.
More Details:
- Host:Rabbit
- Species: Multi-Species
- Cross-Reactivity: Canine: 100%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Bovine: 93%, Sheep: 93%, Zebrafish: 86%
- Target: Furin (PACE)
- Gene ID: 5045
- Gene Alias: FUR, PACE, PCSK3, SPC1
- Swissprot ID: P09958
- Molecular Weight: 74kDa
- Purification: Affinity Purified
- Clonality: Polyclonal
- Storage Conditions:-20C
Store short-term at 2-8C for up to one week. For longer-term storage, aliquot into working volumes to avoid multiple freeze-thaw cycles and store at -20C. This product can be used for a wide range of research applications, including WB, and more. At Innovative Research, we provide reliable, consistent products that deliver reliable, consistent results.
This material is sold for in-vitro use only for manufacturing and research. This material is not suitable for human or animal use. While we make every effort to ensure the safety of our products, we recommend handling any biological materials with standard precautions as if capable of spreading infectious disease. The statements herin are offered for informational purposes only to be used solely for your consideration, investigation, and verification.
Please be aware the image pictured is for illustrative purposes only, and your product packaging and appearance may vary.
Get in touch with our team! Please include any relevant information (product name, etc)